| Desktop | 62/100 | ❗ |
| Mobile | 26/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 13 KB | ✔ |
| Compression | 5 KB (-64.5%) | ✔ |
| Text/Html Ratio | 1507 / 13602 (bytes) = 11.08% | ✔ |
| Load Time | 6.6 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 9 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | No | ✔ | Images Without ALT | 3 / 3 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| retailer | 2 | ✘ | ✘ | ✘ |
| click | 2 | ✘ | ✘ | ✘ |
| seller | 2 | ✘ | ✘ | ✘ |
| provided | 2 | ✘ | ✘ | ✘ |
| video | 2 | ✘ | ✘ | ✘ |
| customers | 2 | ✘ | ✘ | ✘ |
| used | 2 | ✘ | ✘ | ✘ |
| products | 2 | ✘ | ✘ | ✘ |
| purchase | 1 | ✘ | ✘ | ✘ |
| through | 1 | ✘ | ✘ | ✘ |
| agree | 1 | ✘ | ✘ | ✘ |
| productsthat | 1 | ✘ | ✘ | ✘ |
| thattheir | 1 | ✘ | ✘ | ✘ |
| problem | 1 | ✘ | ✘ | ✘ |
| make | 1 | ✘ | ✘ | ✘ |
|
With 6.6 seconds in page load, 13 KB of page size and all other reports below, the antiagingwrinklecreamreviews.com has a SEO score of 60 out of 100 |
| Title | The Lost Book of Remedies |
| Description | The Lost Book of Remedies is helping Americans achieve medical self-sufficiency even in the darkest times using the time-tested methods of our grandparents without spending lots of money on toxic drugs and without side effects |
| Keyword |
| Age | 0 Years, 4 Days |
| Created | 14th-Jul-2020 |
| Updated | 14th-Jul-2020 |
| Expiry | 14th-Jul-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| antiagingwrinklecreamreviews.com | A | 537 | ip:184.168.131.241 |
| antiagingwrinklecreamreviews.com | NS | 3600 | target:ns23.domaincontrol.com |
| antiagingwrinklecreamreviews.com | NS | 3600 | target:ns24.domaincontrol.com |
| antiagingwrinklecreamreviews.com | SOA | 600 | mname:ns23.domaincontrol.comrname:dns.jomax.netserial:2020071401refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: antiagingwrinklecreamreviews.com Registry Domain ID: 2545923671_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.wildwestdomains.com Registrar URL: http://www.wildwestdomains.com Updated Date: 2020-07-14T07:33:21Z Creation Date: 2020-07-14T07:33:20Z Registrar Registration Expiration Date: 2021-07-14T07:33:20Z Registrar: Wild West Domains, LLC Registrar IANA ID: 440 Registrar Abuse Contact Email: abuse@wildwestdomains.com Registrar Abuse Contact Phone: +1.4806242505 Reseller: DomainRightNow Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Registrant State/Province: California Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=antiagingwrinklecreamreviews.com Admin Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=antiagingwrinklecreamreviews.com Tech Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=antiagingwrinklecreamreviews.com Name Server: NS23.DOMAINCONTROL.COM Name Server: NS24.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-07-18T05:00:00Z |
| Server IP | 184.168.131.241 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| antiagingwrinklecreamreviews.net | Available |
| antiagingwrinklecreamreviews.org | Available |
| antiagingwrinklecreamreviews.biz | Already Registered |
| antiagingwrinklecreamreviews.io | Already Registered |
| antiagingwrinklecreamreviews.info | Available |
| Domains (TLD) | Status |
|---|---|
| qntiagingwrinklecreamreviews.com | Available |
| wntiagingwrinklecreamreviews.com | Available |
| zntiagingwrinklecreamreviews.com | Available |
| xntiagingwrinklecreamreviews.com | Available |
| abtiagingwrinklecreamreviews.com | Available |
| Austincabinetsdirect.net |
| Volksbank-uckermark.com |
| Ocean-translate.com |
| Alakahood.com |
| Posn1688.com |
| Opshop.world |
| Duhamtech.net |
| 1756artesian.info |
| Nebiogluasm.com |
| Huuduong.net |